Transcript | Ll_transcript_136409 |
---|---|
CDS coordinates | 151-1053 (+) |
Peptide sequence | MRLHNVVLVVTLVLCIVTIAGAQGRAPAVRLHKPHSVSGIQNVSYDGRSLLINGQRHLLFSGSIHYTRSTSEMWPDLLDKARHGGLNVIQTYVFWNAHEPEKGKWNFEGNYDLIKFIKLIQQKGMFATLRVGPFIQAEWNHGGLPYWLREVPGIIFRSNNEPFKQHMEAYVTKIIKMMKDEKLFASQGGPIILAQIENEYNHIQLAYDEDGPSYVQWAANMAVAQNIGVPWIMCKQKDAPDPVINACNGRHCGDTFTGPNKPYKPVLWTENWTAQYRVFGDTFTGPNKPYKPVLWTENWTA |
ORF Type | 3prime_partial |
Blastp | Beta-galactosidase 14 from Arabidopsis with 71.37% of identity |
---|---|
Blastx | Beta-galactosidase 14 from Arabidopsis with 71.37% of identity |
Eggnog | beta-galactosidase(COG1874) |
Kegg | Link to kegg annotations (AT4G38590) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416473.1) |
Pfam | Glycosyl hydrolases family 35 (PF01301.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer