Protein coding transcript 242932

• Transcript: Ll_transcript_136400
• CDS coordinates: 2-430 (+)
• Peptide sequence: TLRVGPFIQAEWNHGYVSSSHSFIHSPNLLLSIYHSLIPSSHMYIHTRGLPYWLREVPNIIFRSNNEPFKKHMKNYVSHIIGRVREANLFAPQGGPIILAQVLIFYIILLLLTLFNFLITFQSYKHFISSHFIYSVQIENEYN
• ORF Type: internal

Annotations of Ll_transcript_136400

• Blastp: Beta-galactosidase 11 from Oryza sativa with 48.51% of identity
• Blastx: Beta-galactosidase 11 from Oryza sativa with 48.51% of identity
• Eggnog: beta-galactosidase(COG1874)
• Kegg: Link to kegg annotations (4346248)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412880.1)
• Pfam: Glycosyl hydrolases family 35 (PF01301.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;