Protein coding transcript 243065

• Transcript: Ll_transcript_136562
• CDS coordinates: 89-625 (+)
• Peptide sequence: MQRLNQFFSLWQRHLWNVWVTISELRHSVILKRIKMLLLRRKLKLTSILKGQISYMEEWSLLDRDHSSSLLGATEALRASTLRLPVAEKAIADVPNLKDALGSAVDVMQAMGPPIYSLSSKVEETNCLVAEMQKITSKERFLLEQCKDFLSTLAAMQVKDCSLRTHMLQLSRVPNSRT*
• ORF Type: complete

Annotations of Ll_transcript_136562

• Blastp: Protein SNOWY COTYLEDON 3 from Arabidopsis with 67.92% of identity
• Blastx: QWRF motif-containing protein 2 from Arabidopsis with 62.07% of identity
• Eggnog: expressed protein(ENOG4111T26)
• Kegg: Link to kegg annotations (AT3G19570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428892.1)
• Pfam: QWRF family (PF04484.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;