Protein coding transcript 243071

• Transcript: Ll_transcript_136559
• CDS coordinates: 1-786 (+)
• Peptide sequence: VNQCSLPLPPSDFTASDTDSVSSGSTSGAQDCVGVAKGLREPHGTVVSSRFWQETNSRLRRLQDPGSPLSTSPGSRMGVASKCNTAQLKRYNSDGPVLSPRTTASPIRGNARPASPNKLWASSPSRGNASPARVRSAVASSINSGSSNPPSILSFSAEVRRGKIKEDRIYDAHTLRLLYNRYVQWRFVNARADATFMMQKLNAERHLWNAWVTISELRHSVILKRTKLLLLRQNLKLSSILKGQVQFRAYDFKVMALVQCM*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_136559

• Blastp: Protein SNOWY COTYLEDON 3 from Arabidopsis with 59.92% of identity
• Blastx: QWRF motif-containing protein 2 from Arabidopsis with 60.48% of identity
• Eggnog: expressed protein(ENOG4111T26)
• Kegg: Link to kegg annotations (AT3G19570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428891.1)
• Pfam: QWRF family (PF04484.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;