Transcript | Ll_transcript_134484 |
---|---|
CDS coordinates | 44-1126 (+) |
Peptide sequence | MEAVSAWGNTPLASVDPEIHDLIEHEKHRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDQIENLCRSRALQAFHLDAQAWGVNVQPYSGSPANFAAYTAVLQPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVNSSTGYIDYDRLEEKALDFRPKLIICGGSAYPRDWDYAKIRAVADKCGALMLCDMAHISGLVAAQEANNPFEYCDIVTTTTHKSLRGPRAGMIFYRKGPKPPKKGQPENAVYDFEDKINFAVFPSLQGGPHNHQIGALAVALKQATTPGFKAYAKQVKANAVALGNFLISKGYSLVTGGTENHLVLWDLRPLGLTGNKG* |
ORF Type | complete |
Blastp | Serine hydroxymethyltransferase 4 from Arabidopsis with 90.81% of identity |
---|---|
Blastx | Serine hydroxymethyltransferase 4 from Arabidopsis with 90.81% of identity |
Eggnog | Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF- independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism (By similarity)(COG0112) |
Kegg | Link to kegg annotations (AT4G13930) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416596.1) |
Pfam | Serine hydroxymethyltransferase (PF00464.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer