Protein coding transcript 243168

• Transcript: Ll_transcript_134487
• CDS coordinates: 44-1459 (+)
• Peptide sequence: MEAVSAWGNTPLASVDPEIHDLIEHEKHRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDQIENLCRSRALQAFHLDAQAWGVNVQPYSGSPANFAAYTAVLQPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVNSSTGYIDYDRLEEKALDFRPKLIICGGSAYPRDWDYAKIRAVADKCGALMLCDMAHISGLVAAQEANNPFEYCDIVTTTTHKSLRGPRAGMIFYRKGPKPPKKGQPENAVYDFEDKINFAVFPSLQGGPHNHQIGALAVALKQATTPGFKAYAKQVKANAVALGNFLISKGYSLVTGGTENHLVLWDLRPLGLTGNKVEKLCDLCNITVNKNAVFGDSSALAPGGVRIGTPAMTSRGLVEKDFEQIGEFLHRAVALTLEIQKEYGKLLKDFNKGLVNNKAIEDLKTDVEKFSASFDMPGFLVSEMKYKD*
• ORF Type: complete

Annotations of Ll_transcript_134487

• Blastp: Serine hydroxymethyltransferase 4 from Arabidopsis with 89.81% of identity
• Blastx: Serine hydroxymethyltransferase 4 from Arabidopsis with 89.81% of identity
• Eggnog: Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF- independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism (By similarity)(COG0112)
• Kegg: Link to kegg annotations (AT4G13930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416596.1)
• Pfam: Serine hydroxymethyltransferase (PF00464.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;