Protein coding transcript 243259

• Transcript: Ll_transcript_134634
• CDS coordinates: 503-1828 (+)
• Peptide sequence: MGAASESGSVECLSKTMSSMPGFRFHPTDEELVMYYLKRKICGKRLKLDVIHETDVYKCDPEELPGLSVLKTGDRQWFFFCHRDRKYPNGARSNRGTRHGFWKATGKDRNITCNNRAVGVKKTLVFYRGRAPNGERTDWVMHEYTMDEEELRRCPGVKDYYALYKVFKKSGPGPKNGEQYGAPFKEEEWVDDDVVDFSINSADCEVPIPNAVIVDNDQLQPLLDDEIVDFIYGMLDDEQHANAGFPLVVAEGSQSTVVDHLSDAKIFPEPSGIFQSNGQHHDVLPSFDFNQAAVNSQLHVSDALEVTSAPNIQIEEFHFCEEDFLEINDLLIGTEPTQSNVENPGENLQFADGLSEFDLYADMFLELGPITQEDFSCASMNSPETIVVSQNYQKQSNPENANITGVEYWMHDEINTPSGADSFVDSFSLPTTDASFKFHLC*
• ORF Type: complete

Annotations of Ll_transcript_134634

• Blastp: NAC domain-containing protein 17 from Arabidopsis with 51.71% of identity
• Blastx: NAC domain-containing protein 17 from Arabidopsis with 51.71% of identity
• Eggnog: NAC domain containing protein(ENOG410Y9FR)
• Kegg: Link to kegg annotations (AT1G34190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442022.1)
• Pfam: No apical meristem (NAM) protein (PF02365.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;