Transcript | Ll_transcript_135144 |
---|---|
CDS coordinates | 263-616 (+) |
Peptide sequence | MMQCLEGLNHLCAVVAHFLCHEDSSKQPKVFKNPQAIADKTVFKVNEIEALYELFKKISGGVIDDGLINKENFQMALFKTNKKESLFADRLFELFVKNHHGVLDFEAFACGLSVFHPN |
ORF Type | 3prime_partial |
Blastp | Calcineurin B-like protein 3 from Oryza sativa with 64.41% of identity |
---|---|
Blastx | Calcineurin B-like protein 3 from Oryza sativa with 64.41% of identity |
Eggnog | Calcium-binding protein(COG5126) |
Kegg | Link to kegg annotations (4333502) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425185.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer