Protein coding transcript 243314

• Transcript: Ll_transcript_135145
• CDS coordinates: 76-429 (+)
• Peptide sequence: MMQCLEGLNHLCAVVAHFLCHEDSSKQPKVFKNPQAIADKTVFKVNEIEALYELFKKISGGVIDDGLINKENFQMALFKTNKKESLFADRLFELFVKNHHGVLDFEAFACGLSVFHPN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_135145

• Blastp: Calcineurin B-like protein 3 from Oryza sativa with 64.41% of identity
• Blastx: Calcineurin B-like protein 3 from Oryza sativa with 64.41% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (4333502)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425185.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;