Protein coding transcript 243318

• Transcript: Ll_transcript_135170
• CDS coordinates: 1147-1593 (+)
• Peptide sequence: MLQCLDGLKHLCAAVVNCCHHDSSKQPRGLENPEVLARETVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRPISSGLRFSISSNTSFWCLTCLIQSTMGYLISKSLHVLFLSFIPMHQLMIRLSVRMTNF*
• ORF Type: complete

Annotations of Ll_transcript_135170

• Blastp: Calcineurin B-like protein 3 from Oryza sativa with 82.02% of identity
• Blastx: Calcineurin B-like protein 3 from Oryza sativa with 82.02% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (4333502)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450487.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;