Transcript | Ll_transcript_136917 |
---|---|
CDS coordinates | 391-1167 (+) |
Peptide sequence | MSSEIEEVQSRDQQLPSASASSSAGGEVDDESLRNDVYAAAAYGDLEKLHRLVEQEGCTVTEPDGLGYYALQWAALNNRSAAAQYIIEHGGDINAIDHTGQTALHWSAVRGAIQVAELLLQEGARVNAADMNGYQTTHVAAQYGQTAFLYHVVSKWNADPDVPDNDGRSPLHWAAYKGFADSIRLLLFLDAHRGRQDKEGCTPLHWAAIRGNMEACTVLVQAGKKEDLMVTDNTGLTPAQLASDKNHRQVAFFLVGVL* |
ORF Type | complete |
Blastp | Protein S-acyltransferase 24 from Arabidopsis with 83.07% of identity |
---|---|
Blastx | Protein S-acyltransferase 24 from Arabidopsis with 83.07% of identity |
Eggnog | Ankyrin Repeat(COG0666) |
Kegg | Link to kegg annotations (AT5G20350) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440946.1) |
Pfam | Ankyrin repeats (3 copies) (PF12796.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer