Protein coding transcript 243347

• Transcript: Ll_transcript_136919
• CDS coordinates: 333-866 (+)
• Peptide sequence: MSSEIEVVEELQSRDHQLPLASSASSSAGAEVAEESLRNDVYTAAAYGDLEKLHRLVQQEGCTVTEPDGLGYYALQWAALNNRSAAAQYIIEHGGDVNATDHTGQTALHWSAVRGAIQVAELLLQEGARVNAADMNGYQTTHVAAQYGQTAFLYHVVSKWNADPDVPDNDGRSPLHW*
• ORF Type: complete

Annotations of Ll_transcript_136919

• Blastp: Protein S-acyltransferase 24 from Arabidopsis with 82.49% of identity
• Blastx: Protein S-acyltransferase 24 from Arabidopsis with 79.66% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (AT5G20350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440946.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;