Transcript | Ll_transcript_136096 |
---|---|
CDS coordinates | 2-469 (+) |
Peptide sequence | KNLITKLNQNQCCDPVHKQTLLFDVNAELLCCHYKNSVTVYVSAFYLKTLVVLIFSSLSLSKPQKLFHFSGMAATPTWQPQEEGFKEICGLLEQQISPLSSADKSQIWHHLQNYSHLPDFNNYLAFIFSRAEVNMDVIVCDIEFFCINNNNQAESD |
ORF Type | internal |
Blastp | Transportin-1 from Arabidopsis with 66.13% of identity |
---|---|
Blastx | Transportin-1 from Arabidopsis with 66.13% of identity |
Eggnog | Transportin(ENOG410XPK2) |
Kegg | Link to kegg annotations (AT2G16950) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428313.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer