Protein coding transcript 243427

• Transcript: Ll_transcript_136087
• CDS coordinates: 2-1195 (+)
• Peptide sequence: KNLITKLNQNQCCDPVHKQTLLFDVNAELLCCHYKNSVTVYVSAFYLKTLVVLIFSSLSLSKPQKLFHFSGMAATPTWQPQEEGFKEICGLLEQQISPLSSADKSQIWHHLQNYSHLPDFNNYLAFIFSRAEGKSVEVRQAAGLYLKNNLRTGYKAMLPAYQQYLKSELLPCLGAADKHIRSTAGTIISVVVQIGGLVEWPELLQALVNCLDSNDLNHMEGAMDALSKICEDVPQLLDSDVPGLAERPINIFLPRLFKFFQSPHASLRKLALGSVNQYPMLMPSALYLSMDQYLQGLFILANDPNAEVRKLVCAAFVQIIEVCPSFLEPHLRNVIEYMLQVNKDTDEEVALEACEFWSAYFDAQLPPENFREFLPRLIPVKTQLYMFSFIIFLLKYM*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_136087

• Blastp: Transportin-1 from Arabidopsis with 75.48% of identity
• Blastx: Transportin-1 from Arabidopsis with 75.48% of identity
• Eggnog: Transportin(ENOG410XPK2)
• Kegg: Link to kegg annotations (AT2G16950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428313.1)
• Pfam: Importin-beta N-terminal domain (PF03810.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;