Protein coding transcript 243456

• Transcript: Ll_transcript_136327
• CDS coordinates: 3-494 (+)
• Peptide sequence: ETFPLGMQGARHDAFSASKLFNFTNDIDNSYLRMGSSYFGNNTMPMLRTVSTELNIGSSQSEDLSPNSHSSLPSFGTDFAGGQNCNASKVGSGSFLLFGKIIQPVGSDIGNAGCMGDHASKGCDDGENEGLDNPSNHSLTYSNLLNRHDVQSQRPSPVEMCYM*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_136327

• Blastp: Auxin response factor 17 from Arabidopsis with 37.67% of identity
• Blastx: Auxin response factor 17 from Arabidopsis with 37.67% of identity
• Eggnog: auxin response factor(ENOG410ZJKK)
• Kegg: Link to kegg annotations (AT1G77850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430759.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;