Transcript | Ll_transcript_136348 |
---|---|
CDS coordinates | 3-494 (+) |
Peptide sequence | ETFPLGMQGARHDAFSASKLFNFTNDIDNSYLRMGSSYFGNNTMPMLRTVSTELNIGSSQSEDLSPNSHSSLPSFGTDFAGGQNCNASKVGSGSFLLFGKIIQPVGSDIGNAGCMGDHASKGCDDGENEGLDNPSNHSLTYSNLLNRHDVQSQRPSPVEMCYM* |
ORF Type | 5prime_partial |
Blastp | Auxin response factor 17 from Arabidopsis with 37.67% of identity |
---|---|
Blastx | Auxin response factor 17 from Arabidopsis with 37.67% of identity |
Eggnog | auxin response factor(ENOG410ZJKK) |
Kegg | Link to kegg annotations (AT1G77850) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430759.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer