Transcript | Ll_transcript_136288 |
---|---|
CDS coordinates | 841-1986 (+) |
Peptide sequence | MVGLITRTQLKAALPRLVPTILDLYKKDQDIAFLATCSLHHLLNASLLSESGPPMIDFEDLTLILSTLLPVVSFNSDSNDQSDFSVGLKMYNEVQHCFLTVGLVYPEDLFLFLVNKCRLREEPLTFGALCVLKHLLPRLSEAWHSKIPVLVEAVKSLLEELNLGVQKALSELIVVMASHCYLVGSSGELFIEYLVRHCALTDQHWSDFESIPYKKTEMKIGAVTPAELRAVCEKGLLLVTITIPEMEHILWPFLLRMIVPRSYTGAVATVCRCISELWRHRSYGNDMLSECKNRPDMPIAEELLARLIVLLHNPLAREQLATQILTVLCLLAPLFPNNINLFWQDEIPKMKAYVSDTEDLKQDPQCQDIWDDMIINESFLL* |
ORF Type | complete |
Blastp | Protein SHOOT GRAVITROPISM 6 from Arabidopsis with 68.38% of identity |
---|---|
Blastx | Protein SHOOT GRAVITROPISM 6 from Arabidopsis with 69.36% of identity |
Eggnog | Heat repeat(ENOG410XQE8) |
Kegg | Link to kegg annotations (AT2G36810) |
CantataDB | Link to cantataDB annotations (CNT0002789) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425604.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer