Protein coding transcript 243475

• Transcript: Ll_transcript_136295
• CDS coordinates: 2-442 (+)
• Peptide sequence: AKHCPCPFCKEGPEAPSPSYLYNSFSFLNSSMASTSIPAPEAVQVLVSLLSDDSSTVRKSSMSSLKDIAALNPFLVLECCAAVSRGGRRGFGNMAGVFQVMAFGVRALDKRDVDPAFMAKLAKIATAEMISSKVFSVFYLYFVVSC*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_136295

• Blastp: Protein SHOOT GRAVITROPISM 6 from Arabidopsis with 70% of identity
• Blastx: Protein SHOOT GRAVITROPISM 6 from Arabidopsis with 71.84% of identity
• Eggnog: Heat repeat(ENOG410XQE8)
• Kegg: Link to kegg annotations (AT2G36810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425604.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;