| Transcript | Ll_transcript_136300 |
|---|---|
| CDS coordinates | 350-694 (+) |
| Peptide sequence | MKATLGFFAIPNDPVHVVNPLIDNLITLLCAILLTSGEDGRSRAELLLVILRQIDQFVSSPVEYQRKRGCHAVHEMLLKFRLVCVSGYCGLGSQGSHVHNKLIDRTIYGNFSKLP |
| ORF Type | 3prime_partial |
| Blastp | Protein SHOOT GRAVITROPISM 6 from Arabidopsis with 73.91% of identity |
|---|---|
| Blastx | Protein SHOOT GRAVITROPISM 6 from Arabidopsis with 72.9% of identity |
| Eggnog | Heat repeat(ENOG410XQE8) |
| Kegg | Link to kegg annotations (AT2G36810) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019425606.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer