Protein coding transcript 243532

• Transcript: Ll_transcript_134899
• CDS coordinates: 508-1377 (+)
• Peptide sequence: MSRYTVGKITPIQRREVRASDFGPRASFWMNFPKDGSQLTPPHQSEDFKWKDYCPMVFRNLRELFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDRFMIKTLRRSEVKVLLRMLPDYHNHVKSYENTLITKFFGLHRIIPSSGQKFRFVVMGNMFCTELRIHRRFDLKGSSLGRSSDKIEIDENTTLKDLDLNYCFYLEPSWRESLLKQIEIDNKFLEAQHIMDYSLLLGVHYRAPQHLHPVMSYNRSISGDGLAMLAEEGAYQIRSRRLMICDWCLLIDVYL*
• ORF Type: complete

Annotations of Ll_transcript_134899

• Blastp: Phosphatidylinositol 4-phosphate 5-kinase 9 from Arabidopsis with 83.33% of identity
• Blastx: Phosphatidylinositol 4-phosphate 5-kinase 9 from Arabidopsis with 83.33% of identity
• Eggnog: whole genome shotgun sequence(COG4642)
• Kegg: Link to kegg annotations (AT3G09920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461020.1)
• Pfam: Phosphatidylinositol-4-phosphate 5-Kinase (PF01504.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;