Protein coding transcript 243573

• Transcript: Ll_transcript_80892
• CDS coordinates: 110-1612 (+)
• Peptide sequence: MGLKKFLKPISKPQLDYHPLPPLSPIPNPPLPSPPPHTSPPPPSPPTLSLSPLPHHHFHHLQLFLKTHLSPPFTPLSLLHFLKSKLHHHPSFSHYDFHIFNWASKIDSFRHTHLTFHWMAQTLSVTHRFDQLRTLIEFIASNPCPCSDGTIFSCPQIEPIFRFVIHGYCKVGNFDDALYAFRTMVRLIDGRPSVVVCNILLHGFVKCGRFDRALGFYHDEMVRYRVKPDVVSFNILISGYCRDSRFESALEMFKEMREMGCDPNVVTFNTLVKGLFREGKVEEGIGMVNEMIELGYRISDVTCEILVHGLCKEGRVLQACEMLVELSKRGVLPKGYDYFGLVEVLCGEGRVVRALELIYELWDRGSVPSLIACTVMVDGLSRSGKSEEALSLVEKMLKEGMVLDIVTFNCVLQDICNVGRTKEANKLRLLASSKGLELDGMTYKILVTGYTEEGNRKEGELVVDEMLDRGFIPSLASYNKLMNGLSNCRRSTLKVNKFGC*
• ORF Type: complete

Annotations of Ll_transcript_80892

• Blastp: Pentatricopeptide repeat-containing protein At2g36240 from Arabidopsis with 52.98% of identity
• Blastx: Pentatricopeptide repeat-containing protein At2g36240 from Arabidopsis with 55.16% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT2G36240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424640.1)
• Pfam: PPR repeat (PF01535.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;