Protein coding transcript 243595

• Transcript: Ll_transcript_78721
• CDS coordinates: 123-1187 (+)
• Peptide sequence: MSSIRRLSGEESQALYSLLKAEQRPIHEIVSEFNSNISRTRHFTLCSYLLMLLQDNKILNTTQRLIAFSLLLEAYASQKPASNPFISFILNAACHEDSERVVRAFILQLLGVDGSISGKEFLKQSASDYVKGFDQSLHDFPSLDQLQQQFPDDVHLEPYHHLFKDGSVKNVVPDPDVPSNCDIDSPEFDLHPGSKPKIGSGDKEEAVVGLLSNFSLEGLRPHWIRPIPPRLPILDEELVWLNPDDNHELMWDYSMCIDTSRGAAVRDLIANALKGALAPAQQEKVLVELANDPKLVYHCGLTPRKLPELVENNPLIAIDVLTKLINSPEIAEYAFCLYVIFLSLVYKDPITIIFF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_78721

• Blastp: CCR4-NOT transcription complex subunit 11 from Homo with 35.07% of identity
• Blastx: CCR4-NOT transcription complex subunit 11 from Danio with 32.25% of identity
• Eggnog: chromosome 2 open reading frame 29(ENOG410XPKT)
• Kegg: Link to kegg annotations (55571)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432523.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;