Protein coding transcript 243599

• Transcript: Ll_transcript_78709
• CDS coordinates: 123-1187 (+)
• Peptide sequence: MSSIRRLSGEESQALYSLLKAEQRPIHEIVSEFNSNISRTRHFTLCSYLLMLLQDNKILNTTQRLIAFSLLLEAYASQKPASNPFISFILNAACHEDSERVVRAFILQLLGVDGSISGKEFLKQSASDYVKGFDQSLHDFPSLDQLQQQFPDDVHLEPYHHLFKDGSVKNVVPDPDVPSNCDIDSPEFDLHPGSKPKIGSGDKEEAVVGLLSNFSLEGLRPHWIRPIPPRLPILDEELVWLNPDDNHELMWDYSMCIDTSRGAAVRDLIANALKGALAPAQQEKVLVELANDPKLVYHCGLTPRKLPELVENNPLIAIDVLTKLINSPEIAEYFTVLVNMDMSLHSMEVVNRLTT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_78709

• Blastp: CCR4-NOT transcription complex subunit 11 from Danio with 37.75% of identity
• Blastx: CCR4-NOT transcription complex subunit 11 from Danio with 36.29% of identity
• Eggnog: chromosome 2 open reading frame 29(ENOG410XPKT)
• Kegg: Link to kegg annotations (336124)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432523.1)
• Pfam: Uncharacterized conserved protein (DUF2363) (PF10155.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;