Protein coding transcript 243771

• Transcript: Ll_transcript_80392
• CDS coordinates: 1980-2933 (+)
• Peptide sequence: MQCNLIGCRYWRYSINEHGTEDIPAMIEKIHEVKTAELRLSKPDILEETNDNQPYKLCAICHSLGGAAILMYVITRRLQDKPHRLSRLVLLSPAGFHFDSNIVFSVVELLLILLAPVLSPLVPAFYIPTRFFRMIVFKLAQDLHNLPAVGGLVQTLMSYVVGGDSSNWVGVLGLPHYNMNDMPGVSFRVAIHLAQMKRSGKFRMFDYGSQSVNMRVYGSPEPLDLGENYGLINIPVDLVAGQKDKVIRPSMVKRHYKLMKDASVNVSYNEFEYAHLDFTFSHREELLSYVMSRLLLVNPKSQRAARSRKTGQAATSM*
• ORF Type: complete

Annotations of Ll_transcript_80392

• Blastp: Lipase 3 from Sophophora with 26.94% of identity
• Blastx: Lipase member K from Mus with 44.44% of identity
• Eggnog: Alpha beta hydrolase(COG0596)
• Kegg: Link to kegg annotations (Dmel_CG8823)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458655.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;