Protein coding transcript 243988

• Transcript: Ll_transcript_81188
• CDS coordinates: 537-1031 (+)
• Peptide sequence: MHGDYSGQGIDQLLGVINKIKHNPDDRRIILNAWNPTDLKSMALPPCHMFAQFYVANGELSCQMYQRSADMGLGVPFNIASYALLTCMIAHVCDLVPGDFIHDLGDAHVYRTHVRPLQEQLKRLPKPFPILKINPKKDIDSFAASDFKLIGYDPHPKIEMEMAV*
• ORF Type: complete

Annotations of Ll_transcript_81188

• Blastp: Bifunctional dihydrofolate reductase-thymidylate synthase 2 from Arabidopsis with 83.64% of identity
• Blastx: Bifunctional dihydrofolate reductase-thymidylate synthase 1 from Arabidopsis with 83.95% of identity
• Eggnog: Provides the sole de novo source of dTMP for DNA biosynthesis (By similarity)(COG0207)
• Kegg: Link to kegg annotations (AT4G34570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438170.1)
• Pfam: Thymidylate synthase (PF00303.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;