Protein coding transcript 244012

• Transcript: Ll_transcript_78472
• CDS coordinates: 253-999 (+)
• Peptide sequence: MASSSERVDLDGNQIKPITICMIGAGGFIGSHLCEKLMNETPHKVLALDVYNDKIKHLLEPDNLPWHGRIHFHRLNIKHDSRLEGLIKMSDLTINLAAICTPADYNTRPLDTIFSNFIDALPVVKYCSENNKRLIHFSTCEVYGKTIGSFLPKDSPLRQDPAYYVLKEDESPCIFGSIEKQRWSYACAKQLIERLIYAEGAENGMDFTIVRPFNWIGPRMDFIPGVDGPSEGVPRVLACFSNVSYFSI*
• ORF Type: complete

Annotations of Ll_transcript_78472

• Blastp: UDP-D-apiose/UDP-D-xylose synthase 2 from Arabidopsis with 89.67% of identity
• Blastx: UDP-D-apiose/UDP-D-xylose synthase 2 from Arabidopsis with 89.67% of identity
• Eggnog: Nad-dependent epimerase dehydratase(COG0451)
• Kegg: Link to kegg annotations (AT1G08200)
• CantataDB: Link to cantataDB annotations (CNT0000331)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453906.1)
• Pfam: NAD dependent epimerase/dehydratase family (PF01370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;