Transcript | Ll_transcript_290495 |
---|---|
CDS coordinates | 2-472 (+) |
Peptide sequence | FCVNGSNMSLVLPENFQHILRLMNTNIDGKRKVMFAMTAIKGVGRRYANIVLKKADVDLDKRAGECSEEEVEKILTIMMNPRQFKIPDWFLNRQKDIVEGKYSQLTSATLDAKLRDDLERLKKIRAHRGMRHYWGLRVRGQHTKTTGRRGRTVGVSK |
ORF Type | internal |
Blastp | 40S ribosomal protein S18 from Spodoptera with 90% of identity |
---|---|
Blastx | 40S ribosomal protein S18 from Spodoptera with 88.55% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (NP_001236608.1) |
Pfam | Ribosomal protein S13/S18 (PF00416.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer