| Transcript | Ll_transcript_78521 |
|---|---|
| CDS coordinates | 259-585 (+) |
| Peptide sequence | MALNSLSICSFKLSSTSNITHSHSKPFTLVSQINSHRNHSQESNKWRKLVSATLATAVIAFSSDISALADLNKFEAEVRGEFGIGSAAQFGSADLRFVSFILHLFVGF* |
| ORF Type | complete |
| Blastp | Thylakoid lumenal protein TL20.3, chloroplastic from Arabidopsis with 66.07% of identity |
|---|---|
| Blastx | Thylakoid lumenal protein TL20.3, chloroplastic from Arabidopsis with 85.85% of identity |
| Eggnog | pathogenesis(COG1357) |
| Kegg | Link to kegg annotations (AT1G12250) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020218225.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer