Protein coding transcript 244228

• Transcript: Ll_transcript_78522
• CDS coordinates: 1015-1488 (+)
• Peptide sequence: MSYRRANFTAADMRESDFSGSTFNGAYLEKAVAYKANFTGADFSDTLMDRMVLNEANLTNAILVRTVLTRSDLGGAIIEGADFSDAVLDLTQKQALCKYANGTNPVTGVSTRTSLGCGNKRRNAYGSPSSPLLSAPPQKLLDRDGFCDEATGLCEAK*
• ORF Type: complete

Annotations of Ll_transcript_78522

• Blastp: Thylakoid lumenal protein TL20.3, chloroplastic from Arabidopsis with 87.74% of identity
• Blastx: Thylakoid lumenal protein TL20.3, chloroplastic from Arabidopsis with 87.74% of identity
• Eggnog: pathogenesis(COG1357)
• Kegg: Link to kegg annotations (AT1G12250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424468.1)
• Pfam: Pentapeptide repeats (8 copies) (PF00805.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;