Transcript | Ll_transcript_78532 |
---|---|
CDS coordinates | 692-1516 (+) |
Peptide sequence | MCIFLCMGGNSTTWMNTAVLVTCIRNFRSNRGPVSGILKGFVGLSTAIFTNICSALFADDPSSFLLMLSIVPFAVCLSGIFFLHEIPAVKSTTAAEDNEETRYFGVLNAFAIVIALYLLAFGFLPNPTALFSTAFAVVLLLMLASPLGIPVHSFFKNRFKPGLDMDVERVKEPLLQKKENETPAEEGEAVVAVKRGTEIGEEHTVVEALSSVEFWIMFVSFLCGVGTGLAVQNNLGQIGLALGYTDVSLFVSLISIFGFFGRIISGSVSEHFIK* |
ORF Type | complete |
Blastp | Protein NUCLEAR FUSION DEFECTIVE 4 from Arabidopsis with 28.11% of identity |
---|---|
Blastx | Protein NUCLEAR FUSION DEFECTIVE 4 from Arabidopsis with 50% of identity |
Eggnog | Nodulin-like(ENOG41105RT) |
Kegg | Link to kegg annotations (AT1G31470) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450972.1) |
Pfam | Nodulin-like (PF06813.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer