Protein coding transcript 244236

• Transcript: Ll_transcript_78534
• CDS coordinates: 1574-2224 (+)
• Peptide sequence: MKSIPFIFGKKTIEDNCSILVYMEKISAGRVSRTCAFPGSDMIASGVRILGGNKKKKAATPRPLWNAASQILMALGYILLAMAMPGSLYIGSVIVGLCYGVRLAITVPTASELFGLKYYGLIYNILILNLPLGSFLFSGLLAGILYDREATAIAGGGNTCVGGHCYRLVFVVMTGACVVGFVLDILLYFRTKKVYNKIYMSRKPNKSSITSIKQSS*
• ORF Type: complete

Annotations of Ll_transcript_78534

• Blastp: Protein NUCLEAR FUSION DEFECTIVE 4 from Arabidopsis with 31.9% of identity
• Blastx: Protein NUCLEAR FUSION DEFECTIVE 4 from Arabidopsis with 50% of identity
• Eggnog: Nodulin-like(ENOG41105RT)
• Kegg: Link to kegg annotations (AT1G31470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450972.1)
• Pfam: Major Facilitator Superfamily (PF07690.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;