| Transcript | Ll_transcript_79157 |
|---|---|
| CDS coordinates | 512-862 (+) |
| Peptide sequence | MVESHLENSFMPIGASSFCTSKSSNNNNNSMLQGDYLQHSFLCSEYGSGGGEFVKHESQSLRPFFDEWPKNKDSWSGLEDEESNHKGFSTTQLSMSIPMSSSNFSTTTSQSPHSGI* |
| ORF Type | complete |
| Blastp | Growth-regulating factor 3 from Oryza sativa with 62.9% of identity |
|---|---|
| Blastx | Growth-regulating factor 5 from Oryza sativa with 67.5% of identity |
| Eggnog | growth-regulating factor(ENOG410YFT7) |
| Kegg | Link to kegg annotations (4336879) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019421711.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer