Protein coding transcript 244347

• Transcript: Ll_transcript_79167
• CDS coordinates: 219-719 (+)
• Peptide sequence: MSIANYTCKFAVSYSSFYGKKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVESQTMTQSPSTVTSVTIAGSSSATGNFQNLAANAFDNLQGSGSGTGLTDYHLDSIPYGIPSKDYRYEEILVIFHSTLLLGNGKIIWLEGIEQKVFHQCHIA*
• ORF Type: complete

Annotations of Ll_transcript_79167

• Blastp: Growth-regulating factor 5 from Oryza sativa with 54.31% of identity
• Blastx: Growth-regulating factor 5 from Oryza sativa with 54.31% of identity
• Eggnog: growth-regulating factor(ENOG410YFT7)
• Kegg: Link to kegg annotations (4339928)
• CantataDB: -
• Mirbase: osa-MIR396d (MI0013049)
• Ncbi protein: Link to NCBI protein (XP_019454355.1)
• Pfam: WRC (PF08879.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;