Protein coding transcript 244350

• Transcript: Ll_transcript_79169
• CDS coordinates: 181-1206 (+)
• Peptide sequence: MDFNLKQWRNQHESEEQHSSKILKLLPGSHQPSEPNTKVSTNLSDSTLSTTNRFPRMGSYFSLEQWQEMELQALIFRYILAGAVVPQELLQSIKKSILHSPTSPYFIHHHSLQHYQPTAAWYWGRGAMDPEPGRCRRTDGKKWRCSRDVVAGHKYCERHMHRGKNRSRKPVELPTPITIASSSSSISSPSLANASLKSPFDILQLNQCPSGTKNESKSLFETQDHVGGDGKSGGNMLRHFFDDWPRSLQQSSDSVGRANSVTCLTISMPESTSSDVSLKLSSGYGEEPCPRNGNVEAEAEQVQLNWAGGWTSTNQVASMGGPLAEALRSSTTTSSPTSVLH*
• ORF Type: complete

Annotations of Ll_transcript_79169

• Blastp: Growth-regulating factor 4 from Arabidopsis with 46.63% of identity
• Blastx: Growth-regulating factor 4 from Arabidopsis with 46.65% of identity
• Eggnog: growth-regulating factor(ENOG410Y9TR)
• Kegg: Link to kegg annotations (AT3G52910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442382.1)
• Pfam: QLQ (PF08880.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;