Transcript | Ll_transcript_79162 |
---|---|
CDS coordinates | 260-946 (+) |
Peptide sequence | MDFDMKQWRNQVHESEEQQQLQQHCTKMPKLHPGSHQASASSALPLFLPEPNTKVSTLSDSTLATTNRFPRMGSYFSLGQWQELELQALIFRYMLAGAAVPNELLQPIKKSLLYSPTTTPYFLHHHSIQHYQPASELMQSGYWGRGAMDPEPGRCRRTDGKKWRCSRDVVVGQKYCERHMHRGKNRSRKPVELPTPITIASSSSSISSPSLANASLKSPFDILQLNQW* |
ORF Type | complete |
Blastp | Growth-regulating factor 3 from Arabidopsis with 58.94% of identity |
---|---|
Blastx | Growth-regulating factor 3 from Arabidopsis with 59.7% of identity |
Eggnog | growth-regulating factor(ENOG410Y9TR) |
Kegg | Link to kegg annotations (AT2G36400) |
CantataDB | - |
Mirbase | osa-MIR396d (MI0013049) |
Ncbi protein | Link to NCBI protein (XP_019442382.1) |
Pfam | QLQ (PF08880.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer