Transcript | Ll_transcript_79166 |
---|---|
CDS coordinates | 164-1036 (+) |
Peptide sequence | MGSYFSLGQWQELELQALIFRYMLAGAAVPNELLQPIKKSLLYSPTTTPYFLHHHSIQHYQPASELMQSGYWGRGAMDPEPGRCRRTDGKKWRCSRDVVVGQKYCERHMHRGKNRSRKPVELPTPITIASSSSSISSPSLANASLKSPFDILQLNQCPSGTKNESKSLFETQDHVGGDGKSGGNMLRHFFDDWPRSLQQSSDSVGRANSVTCLTISMPESTSSDVSLKLSSGYGEEPCPRNGNVEAEAEQVQLNWAGGWTSTNQVASMGGPLAEALRSSTTTSSPTSVLH* |
ORF Type | complete |
Blastp | Growth-regulating factor 4 from Arabidopsis with 51.12% of identity |
---|---|
Blastx | Growth-regulating factor 4 from Arabidopsis with 50.67% of identity |
Eggnog | growth-regulating factor(ENOG410Y9TR) |
Kegg | Link to kegg annotations (AT3G52910) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442382.1) |
Pfam | QLQ (PF08880.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer