| Transcript | Ll_transcript_391819 |
|---|---|
| CDS coordinates | 124-486 (+) |
| Peptide sequence | MAGLAPEGSQFDARRYDANMNELSTSYANGQNMQIESYHGAPRPDDYNSYSTSHVQTQMGKDLKKGKSISRFLTKSWSIADPEITRKKRVAGYKMYYVEGKVKDCFRKSFRWLKNKCTSG* |
| ORF Type | complete |
| Blastp | Eukaryotic initiation factor 4A-7 from Nicotiana with 86.96% of identity |
|---|---|
| Blastx | - |
| Eggnog | - |
| Kegg | Link to kegg annotations (107783883) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019437846.1) |
| Pfam | Domain of unknown function (DUF3511) (PF12023.7) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer