Transcript | Ll_transcript_79797 |
---|---|
CDS coordinates | 83-964 (+) |
Peptide sequence | MDDSLYDEFGNYIGPEIDSDFDSDREEDNDDDGEDTRDRLTNNHDGAASDGEGPANGWITTSNDIDMVDNQVVLAEDKKYYPTAEEVYGEDVETLVMDEDEQSLEQPIIKPVRNIKFEVGVKDSSTYVSSQFLLGLMSNPTLVRNVALVGNLQHGKTMFMDMLVEQTHRMCTFDPQSEKHMRYTDTRVDEQERRISIKAVPMSLVMEDSNSKSYLCNIMDTPGHVNFSDEMTAALRLADGAVLIVDAAEGVMVNSTVLIVSWSSTVNSCYSPLLICCHSFLNLLSHSPVLFST* |
ORF Type | complete |
Blastp | 110 kDa U5 small nuclear ribonucleoprotein component CLO from Arabidopsis with 74.44% of identity |
---|---|
Blastx | 110 kDa U5 small nuclear ribonucleoprotein component CLO from Arabidopsis with 77.25% of identity |
Eggnog | Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post- translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome (By similarity)(COG0480) |
Kegg | Link to kegg annotations (AT1G06220) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463083.1) |
Pfam | 116 kDa U5 small nuclear ribonucleoprotein component N-terminus (PF16004.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer