Protein coding transcript 244388

• Transcript: Ll_transcript_79797
• CDS coordinates: 83-964 (+)
• Peptide sequence: MDDSLYDEFGNYIGPEIDSDFDSDREEDNDDDGEDTRDRLTNNHDGAASDGEGPANGWITTSNDIDMVDNQVVLAEDKKYYPTAEEVYGEDVETLVMDEDEQSLEQPIIKPVRNIKFEVGVKDSSTYVSSQFLLGLMSNPTLVRNVALVGNLQHGKTMFMDMLVEQTHRMCTFDPQSEKHMRYTDTRVDEQERRISIKAVPMSLVMEDSNSKSYLCNIMDTPGHVNFSDEMTAALRLADGAVLIVDAAEGVMVNSTVLIVSWSSTVNSCYSPLLICCHSFLNLLSHSPVLFST*
• ORF Type: complete

Annotations of Ll_transcript_79797

• Blastp: 110 kDa U5 small nuclear ribonucleoprotein component CLO from Arabidopsis with 74.44% of identity
• Blastx: 110 kDa U5 small nuclear ribonucleoprotein component CLO from Arabidopsis with 77.25% of identity
• Eggnog: Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post- translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome (By similarity)(COG0480)
• Kegg: Link to kegg annotations (AT1G06220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463083.1)
• Pfam: 116 kDa U5 small nuclear ribonucleoprotein component N-terminus (PF16004.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;