Protein coding transcript 244479

• Transcript: Ll_transcript_80521
• CDS coordinates: 32-517 (+)
• Peptide sequence: MLKISEKSDVYSFGVVLLEIITGKRPCDPSFPEGQHVIQWVREHLKSKKDPIEVLDPKLQGYPETQMQEMLQALGISLLCTSNRADDRPTMKDVAALLREIRHDPPIGSEPQKLKKIELSSYSSSSFIPAQLMHLHSASHASSLANSSSSAAAYLPPRNQP*
• ORF Type: complete

Annotations of Ll_transcript_80521

• Blastp: LRR receptor-like serine/threonine-protein kinase from Arabidopsis with 48.95% of identity
• Blastx: LRR receptor-like serine/threonine-protein kinase from Arabidopsis with 56.3% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT4G26540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464142.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;