Protein coding transcript 244525

• Transcript: Ll_transcript_78540
• CDS coordinates: 4143-4997 (+)
• Peptide sequence: MSLIVLAIVFCSDCMFLFSEKERLQCNIFEACGCLWAYLADLRTSEGGFHVHYNPFYEPLKHNGPLLPPAAALAPTLWPQFHLRWACPEEAKPGEIEEQCRKIIMKNSEMQKAKEVAERKAKEISNAMESLNAELRMEKQRNSLAMNIAKRTNKENAAIKRAVQSIGCKIHFSASGDCIVDSESNLLKAAPNCSYSSHGKESDGTLHDDKKDMSVSVTVTADDNDGISSIGQVCETLCPFRSADGGCRWPSGGCAQLGSQFVGLKANFDAFDQLSINDSYFNSE*
• ORF Type: complete

Annotations of Ll_transcript_78540

• Blastp: Phosphatidylinositol-3-phosphatase myotubularin-1 from Arabidopsis with 57.03% of identity
• Blastx: Phosphatidylinositol-3-phosphatase myotubularin-2 from Arabidopsis with 76.77% of identity
• Eggnog: Myotubularin related protein(ENOG410XPTU)
• Kegg: Link to kegg annotations (AT3G10550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427916.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;