Protein coding transcript 244542

• Transcript: Ll_transcript_80141
• CDS coordinates: 252-1106 (+)
• Peptide sequence: MSSSGGESTSSDKQKEKARVSRTSLILWHAHQNDAASVRKLLQEDPSLVNARDYDNRTPLHVASLHGWIDVANCLIEFGADVNAQDRWKNTPLADAEGAKRNSMIQLLKTHGGSSYGQNGSHFEPNTVPPPLPNKCDWEVDPSELDFSNSARIGKGSFGEILKAHWRGTPVAVKRILPSLSEDRLVIQDFRHEVNLLVKLRHPNIVQFLGAVTDRKPLMLITEYLRGGDLHQYLKEKGSLNPASAINFSMDIARYAALPLFSFIFYILMIIKEIIKSKREEHKG*
• ORF Type: complete

Annotations of Ll_transcript_80141

• Blastp: Probable serine/threonine-protein kinase DDB_G0271538 from Dictyostelium with 42.11% of identity
• Blastx: Probable serine/threonine-protein kinase DDB_G0271538 from Dictyostelium with 42.11% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (DDB_G0271538)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445929.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;