Protein coding transcript 244547

• Transcript: Ll_transcript_80146
• CDS coordinates: 172-759 (+)
• Peptide sequence: MSSSGGESSTSDKQKEKARVSRTSLILWHAHQNDAASVRKLLQDDPSLVNARDYDNRTPLHVASLHGWLGVANCLIEFGADVNAQDRWKNTPLADAEGAKQNSMIQLLKTHGGSSYGQNGSHFEPNTVPPPLPNKCDWEVDPSELDFSNSARIGKGSFGEILKAHWRGTPVAVKRILPSLSEDRLVMFFCYLRFQ*
• ORF Type: complete

Annotations of Ll_transcript_80146

• Blastp: Potassium channel SKOR from Arabidopsis with 43.75% of identity
• Blastx: Dual specificity protein kinase splA from Dictyostelium with 41.67% of identity
• Eggnog: Potassium voltage-gated channel, subfamily H (Eag-related), member(ENOG410XPSE)
• Kegg: Link to kegg annotations (AT3G02850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445929.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;