Transcript | Ll_transcript_80147 |
---|---|
CDS coordinates | 252-1220 (+) |
Peptide sequence | MSSSGGESTSSDKQKEKARVSRTSLILWHAHQNDAASVRKLLQEDPSLVNARDYDNRTPLHVASLHGWIDVANCLIEFGADVNAQDRWKNTPLADAEGAKRNSMIQLLKTHGGSSYGQNGSHFEPNTVPPPLPNKCDWEVDPTELDFSNSARIGKGSFGEILKAHWRGTPVAVKRILPSLSEDRLVIQDFRHEVNLLVKLRHPNIVQFLGAVTDRKPLMLITEYLRGGDLHQYLKEKGSLNPATAINFSMDIARGMAYLHNEPNVIIHRDLKPRNVLLVNSSADHLKVGDFGLSKLIKVQSSHDVYRMTGETGSCEYSYKFF* |
ORF Type | complete |
Blastp | Dual specificity protein kinase splA from Dictyostelium with 39.7% of identity |
---|---|
Blastx | Dual specificity protein kinase splA from Dictyostelium with 39.7% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (DDB_G0283385) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445929.1) |
Pfam | Ankyrin repeats (3 copies) (PF12796.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer