Protein coding transcript 244550

• Transcript: Ll_transcript_80150
• CDS coordinates: 172-1356 (+)
• Peptide sequence: MSSSGGESSTSDKQKEKARVSRTSLILWHAHQNDAASVRKLLQDDPSLVNARDYDNRTPLHVASLHGWLGVANCLIEFGADVNAQDRWKNTPLADAEGAKQNSMIQLLKTHGGSSYGQNGSHFEPNTVPPPLPNKCDWEVDPSELDFSNSARIGKGSFGEILKAHWRGTPVAVKRILPSLSEDRLVIQDFRHEVNLLVKLRHPNIVQFLGAVTDRKPLMLITEYLRGGDLHQYLKDKGSLNTASAINFSMDIARGMAYLHNEPNVIIHRDLKPRNVLLVNSSADHLKVGDFGLSKLIKVQSSHDVYKMTGETGSYRYMAPEVFKHRRYDKKVDVFSFAMILYEMLEGEPPFATYEPYDGAKRAAEGHRPTIRAKGYTPELIEYVIYVMFLLHNH*
• ORF Type: complete

Annotations of Ll_transcript_80150

• Blastp: Serine/threonine-protein kinase STY17 from Arabidopsis with 32.71% of identity
• Blastx: Serine/threonine-protein kinase STY17 from Arabidopsis with 32.71% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G35780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445929.1)
• Pfam: Ankyrin repeat (PF00023.29)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;