Protein coding transcript 244556

• Transcript: Ll_transcript_80157
• CDS coordinates: 94-624 (+)
• Peptide sequence: MRQGQNGSHFEPNTVPPPLPNKCDWEVDPSELDFSNSARIGKGSFGEILKAHWRGTPVAVKRILPSLSEDRLVIQDFRHEVNLLVKLRHPNIVQFLGAVTDRKPLMLITEYLRGGDLHQYLKEKGSLNPASAINFSMDIARGMAYLHNEPNVIIHRDLKPRNVLLVNSSADHLKVGD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_80157

• Blastp: Probable serine/threonine-protein kinase drkD from Dictyostelium with 43.87% of identity
• Blastx: Probable serine/threonine-protein kinase drkD from Dictyostelium with 43.87% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (DDB_G0281557)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445929.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;