Protein coding transcript 244562

• Transcript: Ll_transcript_80128
• CDS coordinates: 252-1400 (+)
• Peptide sequence: MSSSGGESTSSDKQKEKARVSRTSLILWHAHQNDAASVRKLLQEDPSLVNARDYDNRTPLHVASLHGWIDVANCLIEFGADVNAQDRWKNTPLADAEGAKRNSMIQLLKTHGGSSYGQNGSHFEPNTVPPPLPNKCDWEVDPSELDFSNSARIGKGSFGEILKAHWRGTPVAVKRILPSLSEDRLVIQDFRHEVNLLVKLRHPNIVQFLGAVTDRKPLMLITEYLRGGDLHQYLKEKGSLNPASAINFSMDIARGMAYLHNEPNVIIHRDLKPRNVLLVNSSADHLKVGDFGLSKLIKVQSSHDVYKMTGETGSYRYMAPEVFKHRRYDKKVDVFSFAMILYEMLEGEPPFANLEPYEGAKRAAEGHRPTIREKGYTPDLIE*
• ORF Type: complete

Annotations of Ll_transcript_80128

• Blastp: Serine/threonine-protein kinase STY8 from Arabidopsis with 33.23% of identity
• Blastx: Serine/threonine-protein kinase STY8 from Arabidopsis with 33.23% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G17700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422305.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;