Protein coding transcript 244564

• Transcript: Ll_transcript_80132
• CDS coordinates: 172-1140 (+)
• Peptide sequence: MSSSGGESSTSDKQKEKARVSRTSLILWHAHQNDAASVRKLLQDDPSLVNARDYDNRTPLHVASLHGWLGVANCLIEFGADVNAQDRWKNTPLADAEGAKQNSMIQLLKTHGGSSYGQNGSHFEPNTVPPPLPNKCDWEVDPSELDFSNSARIGKGSFGEILKAHWRGTPVAVKRILPSLSEDRLVIQDFRHEVNLLVKLRHPNIVQFLGAVTDRKPLMLITEYLRGGDLHQYLKEKGSLNPATAINFSMDIARGMAYLHNEPNVIIHRDLKPRNVLLVNSSADHLKVGDFGLSKLIKVQSSHDVYRMTGETGSCEYSYKFF*
• ORF Type: complete

Annotations of Ll_transcript_80132

• Blastp: Dual specificity protein kinase splA from Dictyostelium with 39.7% of identity
• Blastx: Dual specificity protein kinase splA from Dictyostelium with 39.7% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (DDB_G0283385)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445929.1)
• Pfam: Ankyrin repeats (many copies) (PF13857.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;