Protein coding transcript 244565

• Transcript: Ll_transcript_80136
• CDS coordinates: 252-815 (+)
• Peptide sequence: MSSSGGESTSSDKQKEKARVSRTSLILWHAHQNDAASVRKLLQEDPSLVNARDYDNRTPLHVASLHGWIDVANCLIEFGADVNAQDRWKNTPLADAEGAKRNSMIQLLKTHGGSSYGQNGSHFEPNTVPPPLPNKCDWEVDPTELDFSNSARIGKGSFGEILKAHWRGTPVAVKRILPSLSEDRLVM*
• ORF Type: complete

Annotations of Ll_transcript_80136

• Blastp: Potassium channel SKOR from Arabidopsis with 43.75% of identity
• Blastx: Serine/threonine-protein kinase HT1 from Arabidopsis with 48.28% of identity
• Eggnog: Potassium voltage-gated channel, subfamily H (Eag-related), member(ENOG410XPSE)
• Kegg: Link to kegg annotations (AT3G02850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422305.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;