Protein coding transcript 244777

• Transcript: Ll_transcript_81471
• CDS coordinates: 2-994 (+)
• Peptide sequence: NKAAQIQQSGRDGSELSTRDLQKMVQALPQYTEQVEKISLHVEIAGKINKIIRETELRELGQLEQDLVFGDAAAKDVINFLRTKQNTNPEYKLRLLMIYASVYPEKFEGDKATKLMQLAKLSPDDMKVISNMQLLAGSSNKKTPAAGSFSLKFSNQKTKQAARKDRTEEEEETWQLFRFYPMIEELIENLNKGELPKSDYSCKNEPSPVVTEGSVRSKQRTQTAPTTAPHSMRSRRTANWARPRSSDDGYSSDSTLKNVTADFKKMGKRIFVFIIGGATRSELRVCHKMTTKLKREVILGSSSIDDPPQFLTKLKLLCEPHMAMDGLKMF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_81471

• Blastp: Protein transport Sec1a from Arabidopsis with 72% of identity
• Blastx: Protein transport Sec1a from Arabidopsis with 72% of identity
• Eggnog: Vacuolar Protein(COG5158)
• Kegg: Link to kegg annotations (AT1G02010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433637.1)
• Pfam: Sec1 family (PF00995.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;