| Transcript | Ll_transcript_79896 |
|---|---|
| CDS coordinates | 1837-2211 (+) |
| Peptide sequence | MIPVSCFLEVVLDKVRYSRDTKLSITLVLLGVAVCTVTDVSVNAKGFIAAAIAVWSTALQQYYVHFLQRKYSVGSFNLLGHTAPAQAASLLLVGPFMDYWLTNKRVDAYNYGLTSTVSYYFLFF* |
| ORF Type | complete |
| Blastp | UDP-rhamnose/UDP-galactose transporter 4 from Arabidopsis with 82.79% of identity |
|---|---|
| Blastx | UDP-rhamnose/UDP-galactose transporter 5 from Arabidopsis with 64.1% of identity |
| Eggnog | solute carrier family 35 member(ENOG410XP1S) |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019434998.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer